- Recombinant Escherichia coli Uncharacterized protein ymiA (ymiA)
- MyBioSource.com
- Pricing InfoSupplier PageView Company Product Page
- MBS1257162
- 1 mg (E Coli Derived)
- This item requires custom production and lead time is between 5-9 weeks. We can custom produce according to your specifications
- >90%
- Recombinant Protein
- 4,866 Da
- E Coli or Yeast
- 15342
- ECK4433
- Uncharacterized protein ymiA (ymiA)
Sequence
MPSGNQEPRRDPELKRKAWLAVFLGSALFWVVVALLIWKVWG